MGC34821 (Middle Region) antibody

Catalog No. ABIN632865

This anti- antibody is a Rabbit Polyclonal antibody detecting in WB. Suitable for Human.

Quick Overview for MGC34821 (Middle Region) antibody (ABIN632865)

Target: MGC34821

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Product Details

Binding Specificity: Middle Region

Specificity: MGC34821 antibody was raised against the middle region of Mgc34821

Purification: Affinity purified

Immunogen: MGC34821 antibody was raised using the middle region of Mgc34821 corresponding to a region with amino acids VFPILAVPVILLLPETRDLPLPNTIQDVENEKDSRNIKQEDTCMKVTQF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MGC34821 Blocking Peptide, (ABIN5614747), is also available for use as a blocking control in assays to test for specificity of this MGC34821 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MGC34821 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details

Target: MGC34821

Background: The function of MGC34821 protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 61 kDa (MW of target protein)